PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F03656.1.p
Common NameEUGRSUZ_F03656, LOC104450390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 327aa    MW: 35858.5 Da    PI: 6.5925
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F03656.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.22.2e-191461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg WT+eEd +l+ +++q+G+++W++I++  g+ R++k+c++rw +yl
  Eucgr.F03656.1.p 14 RGQWTPEEDNKLASYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                      89********************************************97 PP

2Myb_DNA-binding43.19.4e-1468110246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +++ E++ + ++++ lG++ W+ Ia+ ++ gRt++++k++w++
  Eucgr.F03656.1.p  68 GEFSEAEEQTIMRLHAVLGNR-WSIIAAQLP-GRTDNDVKNYWNT 110
                       789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.129965IPR017930Myb domain
SuperFamilySSF466891.68E-2912108IPR009057Homeodomain-like
SMARTSM007173.2E-141363IPR001005SANT/Myb domain
PfamPF002495.3E-181461IPR001005SANT/Myb domain
CDDcd001677.03E-131761No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129419.89266116IPR017930Myb domain
SMARTSM007171.9E-1366114IPR001005SANT/Myb domain
PfamPF002498.3E-1368110IPR001005SANT/Myb domain
CDDcd001674.69E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGRIPCCEKD SVKRGQWTPE EDNKLASYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGEF SEAEEQTIMR LHAVLGNRWS IIAAQLPGRT DNDVKNYWNT KLKKKLSGMG  120
IDPVTHKPFS HLMAEIATAL PPPHVAHLAE AALGCFKDEM LHLLTKKRVD FQLQRSNAPP  180
GTSTSTCLTT KSDGKEDTVE KIRLGLSRAI LEPDTLPLSK PWEPMGAPAA KFIGSCSGFP  240
SSASEFQYAH SGFGNEGDDG SPWNTSMCTG STCTAGDQQG RLDGIIEEEN GEESKGEKDL  300
GSGSSIFNSD CVLWDLPADD LMNPIM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F03656.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010063219.10.0PREDICTED: protein ODORANT1
SwissprotQ7XQN11e-121MYB80_ORYSJ; Transcription factor MYB80
TrEMBLA0A059BWY10.0A0A059BWY1_EUCGR; Uncharacterized protein
STRINGVIT_19s0015g01280.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM100052635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-117myb domain protein 103